PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.CMJ7K
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 118aa    MW: 13089.7 Da    PI: 4.282
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.CMJ7KgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26039.71.4e-1214161101
       DUF260  61 lvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                  +vyeA ar+rdPvyG++g i +lq q+++l+a+la++++e+
  Araip.CMJ7K   1 MVYEAGARIRDPVYGCAGAICQLQTQVNELQAQLAKAQAEI 41 
                  69**********************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.391141IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-10138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
MVYEAGARIR DPVYGCAGAI CQLQTQVNEL QAQLAKAQAE IANMQFQQAN MVALLYMQMA  60
EANKATATTQ EPPPSPQQSV DNFIASPPHI NNNLNFFDDN TSLNSMWELF GHDHITTF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016169312.14e-84PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9SK086e-26LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0L9UNR14e-48A0A0L9UNR1_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SGG94e-48A0A0S3SGG9_PHAAN; Uncharacterized protein
STRINGGLYMA13G40370.23e-47(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.11e-17LOB domain-containing protein 11